- Recombinant Pyrococcus horikoshii Molybdate/tungstate transport system permease protein wtpB (wtpB)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1031994
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 27,381 Da
- E Coli or Yeast
- Molybdate/tungstate transport system permease protein wtpB (wtpB)
- 1-248
Sequence
MMGRDYALYFFAALGSFLVVYIVLPIVTIFAKQALDFEMLVKTVHDPLVLEALRNSLLTATATALISLFFGVPLGYILARKDFRGKNFVQAIIDVPVVIPHSVVGIMLLVTFSNAILDSYKGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASRIRTFFSISLPMALPSIASGGIMAWARSMSEVGAILIVAYYPKTAQILVMEYFNNYGLRASRPISVMLMLISLSIFVFLRWLIGRVRE